SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0T9T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0T9T7
Domain Number 1 Region: 1-60,90-145
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0000000000000128
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0T9T7
Sequence length 180
Comment (tr|A0A0D0T9T7|A0A0D0T9T7_9TREE) Unplaced genomic scaffold supercont1.2, whole genome shotgun sequence {ECO:0000313|EMBL:KIR42797.1} KW=Complete proteome OX=1296110 OS=Cryptococcus gattii VGII Ram5. GN=I313_01001 OC=Cryptococcus gattii species complex.
Sequence
MVHALKLWASSHKLNDPSGARAPATMSSYCLTLMAIAYLQHIGHLPNLQADTNVPEVCRP
EEGTSEHDAVWISWGKGQGVKAHVGFSLSPPDDWKPSIPNLTAADAIRGFFEVFSLNGSA
PLRGEKFDRVIQIVSILQGGIVPRAKEYGQEVRESQQRRDTLLNLASSLERIRQAEDMIR
Download sequence
Identical sequences A0A095EBI6 A0A0D0T9T7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]