SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0TV52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0TV52
Domain Number 1 Region: 10-38,164-206
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000195
Family Regulator of G-protein signaling, RGS 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D0TV52
Sequence length 493
Comment (tr|A0A0D0TV52|A0A0D0TV52_9TREE) Unplaced genomic scaffold supercont1.10, whole genome shotgun sequence {ECO:0000313|EMBL:KIR39803.1} KW=Complete proteome OX=1296110 OS=Cryptococcus gattii VGII Ram5. GN=I313_04276 OC=Cryptococcus gattii species complex.
Sequence
MVKRAPAISFADFATFLTNKDYTSENLAFVLWHRDYKSKWKLLDKAVRIRGPVPSTSLGH
RYDPFGYLRHGPVALPTRTGEREEEVSRNRLASANAYSMDATAASDRNDRSAKPLKSYFS
RVSSDLHRSRLEASSLACSSSLTPASSYHPLHSLFSPDGTTFLSVDEQPLRDQAQRAFVT
FLKKGGSKELSISDELREYVRSCLEASTAPEYCVGAVDLLIGLTIFLLLTLLLPPSPFSL
RIYRLFSTIFVSFGIMQVYSAYRGFCSQVWRRSNRQVWPWDLDALEDENAKVGDTMGRSD
IIGYEPKPQVRVLQKTVLPGEVRPLSNLGAIESFDSTCKVNIQVSENSTSASQTSLDNSG
GYDIPSQTFDSCNDIAGEFVSECHNSSLGGKLGSISRPCCMRHAILTAKGHKLPIHIQRK
ISPFAFESGREGETGSDNATVTKPPPHSASTQVINPLTSSTLIQIFRLWSTKPKYLQGGK
IIGRFTFLVPKTG
Download sequence
Identical sequences A0A0D0TV52

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]