SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0VS66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0VS66
Domain Number 1 Region: 1025-1148
Classification Level Classification E-value
Superfamily PX domain 1.7e-20
Family PX domain 0.0021
Further Details:      
 
Domain Number 2 Region: 418-574
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.51e-17
Family Regulator of G-protein signaling, RGS 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0VS66
Sequence length 1396
Comment (tr|A0A0D0VS66|A0A0D0VS66_CRYGA) Unplaced genomic scaffold supercont1.6, whole genome shotgun sequence {ECO:0000313|EMBL:KIR48175.1} KW=Complete proteome OX=1296109 OS=Cryptococcus gattii CA1280. GN=I312_02692 OC=Cryptococcus gattii species complex.
Sequence
MPSAALSSPSAAALVALACMLLLYIPQLLSFATLCLSILSLALAALFYAALTTDYARTPQ
RLRHRNALYRLHLNPAPLGSPTKSPARSPLSTFSSQVNSAISTFLGLVVQHFVIPWYSRI
SPSPEFPDAFEELVQKAISRLVEKSEKVDWPSFMVSKILPIITDHLQHYRAVEHLSLAPQ
SLPLPLPRHPHKALIDPHLAAQAIEEHFRQSLSRILPDLLPKSEQTPVVLTLVQEILLGS
IVLPGFQMVCESDFWNRQIDERVGQYLHERKQVDQFLSALSSIPSTSPSVGSPTMTRVRH
KSHAKTPSIDANSSSSQFDFFLKSIRKLWTLGEARRLKADVERELRSAKHTLYEENKEAN
ELGLTHQSSDKGASKDIRKAQKYVERLKKAKSAVDSRIVELSGGSKIYDDSESTLVSPDT
SQPISLYTILSNPSSLAYWLEFMDRRHRSRLVQYWLTIEGFKDPLEATGTDVIEEGKPTE
RNAHDTAIEDVQSLCATYFSAPQSGSVVISPQNQQIIEAAASSSHNLSPQDIARVRRAVF
ASQREVYEQMEDEDWSAFGKSELHLKAVGDLQRTHSAVKNSTTAVIADVQQPDNSRAALS
RTPSPMAQMHHSLPRHQTPALLHRPLQQITPQAPKMVNSLILGSPPSVSSPSFPSDSSYL
QQKRPSLPPTILAVPTTPAGPSISVSEFRALSPPPFERRISESKGSRNNNSNDSAESRKG
SASEMESPQHQLHSPSPSFSPSYTSTPLIHSPKLVSPPPPTAKRSSQLNFLIGNAENSET
DGRDRLFRDEPEDLEEVGEREEEARRIEAIQAALSEIIADDNGKRSSDETPSDVLMNERE
KPRHRGNDMTSSLILDGVADKVGGKRRSRSLEDLKSASLSSTTAFPSDVSLSQEPIRNPS
KLLFEDDLPEDDLSGTPSEEEEDSDIPHNVPLPAPGDLQLTTQISELGTKLIELEKQNEL
LSTLIRQAELTGNQKELKILRKSQSSVQRETRAKQWQKQEFERVQDESRLMPSRSRVSIP
SAAVTEDTENASASTLGVVGPKQVVRYTIHVCQIDDGHPAAKWAVSRRYNEFWELDKNLR
EWASEHGVLEATETLRKLEIPGKSLVGNISANFVESRRIGLEKYLQGLMTSTIICDSPHL
RSFLSRSNSLIPSTNRTQPAITQLTKLPHNLMKTFYKSISPGPSSEDMLNANMVDVMYNG
LGRQISDQGGLVGLGLGSPEVEVTEDHVQVTRGVSVEGMTSFTGPICDLFIELFDLKEKN
WLRRQAVIVILQQFLGGTIERKVRDSFRSITSQSSFLRIIGNFQDTLFPSGKRRTSTAPR
SEEEKAGTRARAGKKLGLLIPDVAANMIGRGNARRAARRVFGVLQDERLNQQLMLRILDA
VMKAIFPSMEGSGVTY
Download sequence
Identical sequences A0A0D0VS66

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]