SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0XT95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0XT95
Domain Number 1 Region: 23-138
Classification Level Classification E-value
Superfamily Prefoldin 7.46e-19
Family Prefoldin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0XT95
Sequence length 140
Comment (tr|A0A0D0XT95|A0A0D0XT95_9TREE) Unplaced genomic scaffold supercont2.2, whole genome shotgun sequence {ECO:0000313|EMBL:KIR88863.1} KW=Complete proteome OX=1296105 OS=Cryptococcus gattii VGIV IND107. GN=I308_00944 OC=Cryptococcus gattii species complex.
Sequence
MSVNLSTPSRTTQSQVYSAHLRNALLPELDNTRQRLSTVETDIAEYALLKDNLVGLQKEQ
GKEVNTMSEMGAGIWVHTTIPDISVITLDLGFDLHLEMPLADAEEYVKKKLEILKKKRDS
LSQKEEFLVWQIGQFQGAMA
Download sequence
Identical sequences A0A0D0XT95

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]