SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D0YL72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D0YL72
Domain Number 1 Region: 20-62,187-253
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000412
Family Regulator of G-protein signaling, RGS 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D0YL72
Sequence length 576
Comment (tr|A0A0D0YL72|A0A0D0YL72_9TREE) Unplaced genomic scaffold supercont1.23, whole genome shotgun sequence {ECO:0000313|EMBL:KIR82325.1} KW=Complete proteome OX=1296103 OS=Cryptococcus gattii EJB2. GN=I306_00652 OC=Cryptococcus gattii species complex.
Sequence
MCAHSLFASHTELALKQLRLCHILNGETCPPISFADFATFLTNKDYTSENLVFVLWYRDY
KSKWKLLDKTVRIGVPVPSTSLGHRYDPFGYLGHGPVALPTRTDEREEEVSRNRLASVNA
YSLDATASDRNDSSAKSLKSYFSRVSSDLPRSRLEASSLACSSSITPATSYHPLHSLFSP
DGTTFLSVDEQPLRDQAQRAFATFLKKGGSKELSISDELREYVRTCLEASTAPESFLPVL
EEIYHTLESQCLPYCVGAVDLLIGLTIFLLLTFLLPPSPFSLRTYRLFSTIFVSFGIMQV
YSAYRGFCSQVWRRSNRQVWPWELDALEDENAEVGDTMGRPDIIGCEPKPQVRVLEKTVL
PGEVRPLSNLGAIENFDSTCKVNIRVSENSISAPQTSLDNSGDYDLPSQTFDSCHVIAGE
FVPVFDNSSLGGKLGTISRPCCMGHDILTGKGHKLPIHIERKISPFAFESGREGETGFDN
ATVTKPPRHSASAQFIYPLTSSMLISNSKAMKHEIHVSPRRKGHMKIHVFGPEKLVEDPR
IKKVYKDIKRNILVMGGVVSVLWVVVCLVVLCAASP
Download sequence
Identical sequences A0A0D0YL72 E6R2X3
XP_003192644.1.73883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]