SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1D8F7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1D8F7
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 1.44e-55
Family Obg GTP-binding protein N-terminal domain 0.00000307
Further Details:      
 
Domain Number 2 Region: 151-322
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-46
Family G proteins 0.0000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D1D8F7
Sequence length 340
Comment (tr|A0A0D1D8F7|A0A0D1D8F7_9RHOB) GTP-binding protein Obg {ECO:0000256|HAMAP-Rule:MF_01454} KW=Complete proteome; Reference proteome OX=935700 OS=Jannaschia aquimarina. GN=jaqu_20640 OC=Rhodobacteraceae; Jannaschia.
Sequence
MKFLDLAKVYIRSGAGGNGAISFRREKYIEYGGPDGGNGGRGGDVVVEAVEGLNTLIDFR
YQQHFFAKNGQGGMGRQRTGKDGDDIVLRVPVGTEILDEDEETVIADLTEVGQRIVLAQG
GNGGFGNLHFKSSTNQAPRRANPGQPGVERTIWLRLKLIADVGLLGLPNAGKSTFLAATS
NARPKIADYPFTTLVPNLGVVGVDGAEFVVADIPGLIEGAHEGRGIGDRFLGHVERCGAL
LHLVDGTSDDVVADYRTVITELEEYGGGLAEKPRLTVLNKIDAVDDVEQKVHYLSAACGA
KVMRMSGVSGEGVTEVLRSLRAMIRPDTSSEEEDGPWSPV
Download sequence
Identical sequences A0A0D1D8F7
WP_043918881.1.14753 WP_043918881.1.72127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]