SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1DTQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1DTQ6
Domain Number 1 Region: 3-170,203-322
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.36e-79
Family WD40-repeat 0.0000503
Further Details:      
 
Domain Number 2 Region: 253-519
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 1.41e-16
Family DPP6 N-terminal domain-like 0.023
Further Details:      
 
Weak hits

Sequence:  A0A0D1DTQ6
Domain Number - Region: 616-630,657-723
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0288
Family Pseudo ankyrin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D1DTQ6
Sequence length 1238
Comment (tr|A0A0D1DTQ6|A0A0D1DTQ6_USTMA) Coatomer subunit alpha {ECO:0000256|PIRNR:PIRNR003354} KW=Complete proteome; Reference proteome OX=237631 OS=Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus). GN=UMAG_04173 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Ustilago.
Sequence
MQMLTKFESKSNRVKGIAFHPRLPLLASSLHNGSIQLWNYQTGTIYDRLEEHDGPVRGIC
FHPSQPLLVSGGDDYKIKVWNHKTRKCLFTLNGHLDYVRTVFFHHEHPWILSASDDQTIR
IWNWQSRTCISILTGHNHYVMCAQFHPKEDLIVSASMDQTVRVWDISALRKKNTSAQPMS
IEEQIARANSGQADLFGNTDAMVKYVLEGHDRGVNWASFHPTLPLIVSAGDDRQIKLWRM
SDTKAWEVDTCRGHFNNVSCALFHPRHELIISDAEDKTIRVWDMGKRTAVQTFRRESDRF
WVLTAHPTLNLFAAGHDNGLIVFKLERERPAFSVHQNTLYYIRDKQVRSLDYSTGADHAL
LTVKRLGNQYVPPRTLSFNPAERSVIVTSVNGDQGTFDVAPLPREAGGDLAESSSVGKRG
QGSSAIFVARNRFAVLDKAAQTIEIRDLNNTVTKTITPPQPTNEIFFGGTASLILSTATG
VVLYDIQQQKTLAELTSPPVKYVVWSIDGSMVALLSKHTITLADKLFASSNLIHETIRIK
SAAWDESGVLLYSTLNHIKYALPQGDNGIIKTLEQPVYLTRVKGKTVSCLDRLARPQNIT
IDPTEFRFKLALVQGKYDDVLTIIKNSNLVGQAIIAFLQKKGYPEIALHFVQDKSTRFDL
AIECGNLDVALETAESLNVDEVWNRLATAALRQGNHKIVERAYQRTKSFDKLSFLYLITG
NTDKLAKMSVIADKRGDHLSRFHNALYLGNAEARSSVLSDVGLEALAYAAAKSNGLDDRA
AAIASQAGMEEEAAEVDRHLDLGEGTSKLAPPTAVSQAYLHNWPILSSEQSYFDRALVAG
NDGGPIFKDNAINGTKTHDIESWLDGEALEQSEEEEEEAFDAAPEDFGEADEAWDLAEEE
VAMPEEEAAVVAPLQETLEGLAAGSSEAEHWLRNSPVAADHAAAGSFETAMTLLSRQAGI
VDFAPLKALFLSSYLAARSYLPAAPSAGPIEVHLRRNNEASDGKVTKAHPTSPRSVKAFA
SGDLQDGYRAVSANKLAEAETIFRRLLHQLVLTPASTEAEATEIQDLIVLCREYILGVSI
ELSRRKLATAEPDNVARNLELAALFTHTQLQPQHQTLALRSAMTEARKVNNYAMAASFAK
RLMDLSPAPAVAQKAQQIISLAERSPRDAVDVPGYDPLEQNFVICAGSFRLITATGAGSV
TDPLTGARYLPEFKGTLCKITQISEVGKLASGLRSFAT
Download sequence
Identical sequences A0A0D1DTQ6
5270.UM04173.1 UM04173 XP_011390661.1.11705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]