SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1DWM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1DWM5
Domain Number 1 Region: 870-917,949-1026
Classification Level Classification E-value
Superfamily PX domain 1.57e-19
Family PX domain 0.0031
Further Details:      
 
Domain Number 2 Region: 417-465,507-574
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-16
Family Regulator of G-protein signaling, RGS 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D1DWM5
Sequence length 1300
Comment (tr|A0A0D1DWM5|A0A0D1DWM5_USTMA) Chromosome 8, whole genome shotgun sequence {ECO:0000313|EMBL:KIS68564.1} KW=Complete proteome; Reference proteome OX=237631 OS=Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus). GN=UMAG_10380 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Ustilago.
Sequence
MLRSPLAVSAIIALAPPLLFNAAIRLHWTNFLWAFPLLLISWTVVLFAAFLFASHIADIR
TLRRTRRSRNSLRSLPRLAFLTPAACKWHTPLATGSLESSPSDSAPEFVQAVEQTIRNAL
DRVAALVTQLDYADLVVRRLIPRITNHIHSYRKAEADFRGSSENAQLAGSESDQTDLFLA
RKFEDGHLHPAVGDMSSPNTKPAEQAFLRSVCSRLLRALMPFPESESASVHIVVRELLSC
TILFAVIESISDPDFWNNLIEQKAGAVIHEQILVGKLRDALDKQESLSTAKTGRTRTVPF
VDIDAKNLLPWSQETKKPDQKSFEAFLRSIRHTTSLLEVRRIKNDIAVQIRKTKANLERL
SDDPSDASRAKLQSYLHRLEAAYTVAEHKIAQLGSDTGIPTVSAKASAGADPNASRVKLH
DVLLNPSSLSFFMEFMDRRKRSILVQFWLLVESFKNPLEDTEADPSAKDEQLNASSGALS
PSRAAIHTLKEEIRMFDQVYYASPLIKVSKRYVDSARQFLAIGQDAPIAALQVWQVRRDV
LRAQKEIYEEMEEEDWPSFRQSDLFLKAAQDLHPNAHLAAGLASSVGSLAAEPSGFMNHK
HTELSDGLQRPGRSIKPNVEHADLFGTDKPMGSESKQLDLFGDSLTGSRSKASAKSDNLD
ILIGGRTQHAGPDGRTPLFREDPLFDEHDDENDGQTEEERGDNSSDVIQVEQVNELHSVL
QSIIDDDIDKTRKRPAGLGSTGPDLGGRSSRSSDKDSYHPSTDSKRGSVVANESETVVQP
GTPRGSKGGTGTDSATANAGFASLPSFNLSQELQKMDAQLEKLEAQADILDALARKAELT
GARSSETRLLAQSIQAVRRESRDIRWQRSQLEQQMAATQLIPGQTRVSIQDTMISVDQEG
KEYAVYLIEIGILDQDASKPSKPSGQSKGRGVGAPTAPTAPTVPTARGWIVGRRYSEFWS
LHQALKERFAAVRALESDFPGKRLVGLVHAPFVDARKAALERYLQALVKLKVACESEELR
IFLSQTAIATMNGMAAQTTNDSVGAAQLTSAGTATPGKQLSAFPGGGLVKTLFKGMSGVA
EGLDDLIGIGPSMLDVVVQRLSAQMQIKSGTTLVQGIADIDMVSQAMDKDATPAELREAA
GAGTTYWTEPICDLFTELFELHEKNNWLRRQAIVILLQQLFGSTVERKIRETFSSALSPL
AISHYLASFQSSLWPNGALKHPSPARSWPEKLALRETANAKLANLIPDLAANLVGRENAR
TGSRRLFAALQNKRLNKHLIYTLLDIFVQDLLAVDHDPPP
Download sequence
Identical sequences A0A0D1DWM5
XP_011389769.1.11705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]