SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1E4Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1E4Y2
Domain Number 1 Region: 12-61,197-291
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.8e-24
Family Regulator of G-protein signaling, RGS 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D1E4Y2
Sequence length 405
Comment (tr|A0A0D1E4Y2|A0A0D1E4Y2_USTMA) Uncharacterized protein {ECO:0000313|EMBL:KIS71039.1} KW=Complete proteome; Reference proteome OX=237631 OS=Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus). GN=UMAG_00956 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Ustilago.
Sequence
MSEKHRPLSLQSSRTRQRLPTLAEVLARRTLPPVDLYCFYLYLQREAAEDALDFWLDVQQ
HENLCRAYFKDLRKSGKSVKEDWPQYYAEALERGSIYNKINGINDQTSTLRKGPETSWDH
QSRVDSPDGNQSTYSPAPSPIPSAVAGSRNASGSGAPLTAPRFPGDPDYLAQQTRAERKS
ILAKRGSVAPTVISRSAAITRTDLIASAERIYARYLLPGSEKEIYLPAPLRIISFPISSS
TLPHPQDVEQQRALARIPDMFHSQKEYVFRTMEADVFPRFLRAKAFGNLTPISVLVRLSL
GLLALWAALATAFSFVFLNVDRAKRCWVILPFSVAVLLLMSHQYELDPILVLLSQSETTP
FRLIRIREPYVHRLLLQRSLSVLLLIALITAALTVLFVFVPGHRL
Download sequence
Identical sequences A0A0D1E4Y2
5270.UM00956.1 XP_011386952.1.11705 UM00956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]