SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1IPD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1IPD3
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.12e-17
Family SMI1/KNR4-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D1IPD3
Sequence length 152
Comment (tr|A0A0D1IPD3|A0A0D1IPD3_BACIU) Uncharacterized protein {ECO:0000313|EMBL:KIU11183.1} KW=Complete proteome OX=1423 OS=Bacillus subtilis. GN=SC09_Contig24orf00069 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MWVNLLEEIRKTEAKYGDELNSPVTDQEIRNFEEAVLGKFPVNEIPSGYKKFLQTVNGLD
FNGLVIYGLDQELLREENDEEVYGFIETNEQWHENDEQKKYLFFGDSDTAWYCLDVIQNE
YLELDKPSGTLMNKFNDFNAMLADALKVSLDN
Download sequence
Identical sequences A0A0D1IPD3 A0A2J6DSQ6 D4FXI0
gi|428279529|ref|YP_005561264.1| WP_014479998.1.23108 WP_014479998.1.31786 WP_014479998.1.32025 WP_014479998.1.32693 WP_014479998.1.33285 WP_014479998.1.47672 WP_014479998.1.51783 WP_014479998.1.52847 WP_014479998.1.55792 WP_014479998.1.67028 WP_014479998.1.84434 WP_014479998.1.89821 WP_014479998.1.92915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]