SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1KJF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1KJF2
Domain Number 1 Region: 4-75
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000429
Family Tetracyclin repressor-like, N-terminal domain 0.0081
Further Details:      
 
Weak hits

Sequence:  A0A0D1KJF2
Domain Number - Region: 103-157
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0192
Family Regulator of G-protein signaling, RGS 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D1KJF2
Sequence length 194
Comment (tr|A0A0D1KJF2|A0A0D1KJF2_KLEAE) TetR family transcriptional regulator {ECO:0000313|EMBL:KIU33943.1} KW=Complete proteome OX=548 OS=Klebsiella aerogenes (Enterobacter aerogenes). GN=SR38_09175 OC=Enterobacteriaceae; Klebsiella.
Sequence
MLVARPRSEDKRIALLDAATEAIANAGIGASTAMIARGAGVAEGTLFRYFATKDILLNAL
YLHLKIGFCRSILEQPDRPADSKGLTRYIWNRLIDWGLANPVAHQAMRQLAISDKITEET
EKQVNESHPDLHQICEKAIQPLFLSPTFRRFGDTIFFALAETTMEFATREPERTEEFKTV
GFEAMWRALGKPDL
Download sequence
Identical sequences A0A0D1KJF2 H5V2S2
WP_002436153.1.100163 WP_002436153.1.91987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]