SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1PQM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1PQM4
Domain Number 1 Region: 15-144
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000017
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D1PQM4
Sequence length 165
Comment (tr|A0A0D1PQM4|A0A0D1PQM4_PSEPU) Uncharacterized protein {ECO:0000313|EMBL:KIU54361.1} KW=Complete proteome; Reference proteome OX=303 OS=Pseudomonas putida (Arthrobacter siderocapsulatus). GN=QV12_01280 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MFENITVTGSPLVLSTDAEVDQAQAVLGTRFPTGYREYVTQFGEGILGGVYVRIYPPHQL
LHGENSQAQWVERINQYWFWDDDKELMPKEKALQCIIIGDTYDGDELIIHPSDPERIYVL
PRHSEAALVAGNGLVEAIEWLCSSNVLTEAFTERDFEPFDSRVQP
Download sequence
Identical sequences A0A0D1PQM4 A0A1T1IT84 A0A1Y3LE83
WP_043859806.1.14628 WP_043859806.1.27209 WP_043859806.1.50741 WP_043859806.1.69624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]