SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1PUT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1PUT5
Domain Number 1 Region: 17-163
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.7e-23
Family SMI1/KNR4-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D1PUT5
Sequence length 176
Comment (tr|A0A0D1PUT5|A0A0D1PUT5_BACTU) Contig0001, whole genome shotgun sequence {ECO:0000313|EMBL:KIU76769.1} KW=Complete proteome OX=1235825 OS=Bacillus thuringiensis Sbt003. GN=C797_01130 OC=Bacillus cereus group.
Sequence
MLRKYYSKNNHLQPFFEEVNKYVDGIHTLNNGINLEDITSLQNELNIQIPDIYKDFVQVC
NGGELFIPGTVLSEIHTAAQGPKQRGGSYLNDSFKKERRPTKMPDTYLIIADLNYGDSIC
IDLESSNGYDATVIQWDRETHSVSRSWNGLVEWLMDTLDEGSLLVDYDGNEKDLDF
Download sequence
Identical sequences A0A0D1PUT5 A0A193CYE4 A0A243N2H1 A0A249XIL4 C3E9N1 J8L1R7 J8N4H2
WP_000944939.1.18914 WP_000944939.1.2251 WP_000944939.1.23540 WP_000944939.1.36221 WP_000944939.1.59997 WP_000944939.1.94308 WP_000944939.1.94373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]