SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1R6R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1R6R7
Domain Number 1 Region: 60-172
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000327
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D1R6R7
Sequence length 178
Comment (tr|A0A0D1R6R7|A0A0D1R6R7_BACTU) Contig0005, whole genome shotgun sequence {ECO:0000313|EMBL:KIU75737.1} KW=Complete proteome OX=1235825 OS=Bacillus thuringiensis Sbt003. GN=C797_07561 OC=Bacillus cereus group.
Sequence
MKEVMKDYFEKFIDKWMEYNNSLPQIAWNEDVDEFIYSGEEDEYGYISWKPIEKGVEFSF
DEIESQYNVQLHDSVKQYFNSYWFLELTGWVSSYNINLHPVIPGIEPDYFISLVKDYAES
KEDIFKFIPIGFESNGMLIVLDNNTGEILVEDFELNEYKRITNSLESLISQLKFKDEQ
Download sequence
Identical sequences A0A0D1R6R7 A0A0U0GLJ4 A0A154AY90 A0A1Y0TNM7 A0A243E617 C2QKP9 C3EDD3 J8LI95
WP_000665915.1.12289 WP_000665915.1.18914 WP_000665915.1.23540 WP_000665915.1.36221 WP_000665915.1.45385 WP_000665915.1.51072 WP_000665915.1.61919 WP_000665915.1.73396 WP_000665915.1.80126 WP_000665915.1.83938 WP_000665915.1.89325 WP_000665915.1.94373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]