SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1RLH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D1RLH8
Domain Number - Region: 23-101
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0384
Family SMI1/KNR4-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D1RLH8
Sequence length 114
Comment (tr|A0A0D1RLH8|A0A0D1RLH8_BACTU) Contig0001, whole genome shotgun sequence {ECO:0000313|EMBL:KIU76731.1} KW=Complete proteome OX=1235825 OS=Bacillus thuringiensis Sbt003. GN=C797_00940 OC=Bacillus cereus group.
Sequence
MKQQIKIAELLKRIETSKQQDIELGTYEIYVFSESELEKGQIGYRYDKHKNSLISEENGK
WQEGWITIGYETDMGDPVFVNIDDDAYPVYTAERGTEKWQPVYIGNMDEIIGQL
Download sequence
Identical sequences A0A0D1RLH8 A0A0J7JXC3 A0A1Q9KS03 A0A243DS42 A0A243HGX8 A0A2C9ZBX0 A0A2J9DIW9 C2REH3 C2T790 C2UK90 C3E9R7 G9Q0I5 J8HNL2 J8J3Y4 J8MKH3 N1LSY9 Q816X2 R8GRH4
gi|30022763|ref|NP_834394.1| NP_834394.1.86172 WP_000813166.1.10055 WP_000813166.1.14006 WP_000813166.1.14039 WP_000813166.1.18914 WP_000813166.1.21055 WP_000813166.1.22699 WP_000813166.1.23540 WP_000813166.1.24680 WP_000813166.1.26513 WP_000813166.1.26637 WP_000813166.1.28237 WP_000813166.1.32784 WP_000813166.1.36221 WP_000813166.1.39957 WP_000813166.1.41518 WP_000813166.1.43442 WP_000813166.1.44956 WP_000813166.1.45317 WP_000813166.1.47975 WP_000813166.1.4964 WP_000813166.1.5025 WP_000813166.1.54240 WP_000813166.1.58822 WP_000813166.1.59058 WP_000813166.1.60153 WP_000813166.1.60334 WP_000813166.1.63902 WP_000813166.1.64282 WP_000813166.1.65803 WP_000813166.1.67873 WP_000813166.1.68562 WP_000813166.1.71114 WP_000813166.1.73457 WP_000813166.1.73594 WP_000813166.1.73790 WP_000813166.1.76804 WP_000813166.1.76902 WP_000813166.1.80649 WP_000813166.1.81773 WP_000813166.1.86619 WP_000813166.1.87768 WP_000813166.1.88154 WP_000813166.1.90352 WP_000813166.1.94308 WP_000813166.1.95576 WP_000813166.1.96287 WP_000813166.1.97670 WP_000813166.1.97842 WP_000813166.1.98604 WP_000813166.1.99212 APC25143 gi|296505159|ref|YP_003666859.1| 226900.BC4688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]