SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1V440 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1V440
Domain Number 1 Region: 22-80,112-193
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.1e-17
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D1V440
Sequence length 196
Comment (tr|A0A0D1V440|A0A0D1V440_ANEMI) Cell wall assembly regulator SMI1 {ECO:0000313|EMBL:SDJ37608.1} KW=Complete proteome; Reference proteome OX=47500 OS=Aneurinibacillus migulanus (Bacillus migulanus). GN=AF333_21415 OC=Aneurinibacillus group; Aneurinibacillus.
Sequence
MSQIDELHKKIEGLLAERVVDDDIEYFEEYKKITGITDKQIDDFERDFSISLPTDFKAFY
KLKDGSGYPLNLLYTSYKDSCIPFTLLSFDDIRDTKKFFCDRDNLMSEYYSDEEISKLDS
RIKPYLFNKRWFPFAQVAGGSLYLMLDFDPTEHGTVGQVIFYVHDPDFVYFIAPTFSDLL
QDTIQNLEDDWYDECR
Download sequence
Identical sequences A0A0D1V440
WP_043066842.1.26437 WP_043066842.1.26869 WP_043066842.1.66442 WP_043066842.1.73273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]