SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1WET9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1WET9
Domain Number 1 Region: 31-91,119-198
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.27e-16
Family SMI1/KNR4-like 0.013
Further Details:      
 
Domain Number 2 Region: 214-459
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000000025
Family PBS lyase HEAT-like repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D1WET9
Sequence length 461
Comment (tr|A0A0D1WET9|A0A0D1WET9_ANEMI) SMI1 / KNR4 family (SUKH-1) {ECO:0000313|EMBL:SDJ67022.1} KW=Complete proteome; Reference proteome OX=47500 OS=Aneurinibacillus migulanus (Bacillus migulanus). GN=AF333_26465 OC=Aneurinibacillus group; Aneurinibacillus.
Sequence
MKIGYGMSLYEQVNRIKEKILLAKEKDSSFDVFGSTKHKYEWNIPISSEEVRDFENRNNI
TLPEAFKLFITEIGNGGAGPYYGIYKVATDSHDGYLSKPCKLHPHLSNEEWGHLTSFEDD
DNLTDEQYDSHYNALFQGMLRIGTQGCTYDMMLVVSGEYKGRVVYIDGDLQKPFFTYENN
FLDWYERWLDEIIQGYEIDWFGMLMGGDDAELMNKFHTSNDEEYKVNAIWGMNKLPHLLP
ETIRFLEEQCHNPSHAIKSVSLQLLTKNCYTKAKSFLQQWLESDNEDDTLKALKYIYWYV
EEDVQDFVKPIKTVLSTTKNPENFRFITYILEKSSEEDASLYVPFFTHPNKEIRTCAIHT
VGKSKEKEKYLQDLIQCLQDDEVSVKRMAIQALRDVTNPILLPCYEKILDEYKTNEHYIL
SNVMHRLEEFGVQAKSILEKAKQHPDKEIKDSAYRMLKEIE
Download sequence
Identical sequences A0A0D1WET9
WP_074715243.1.26437 WP_074715243.1.26869 WP_074715243.1.66442 WP_074715243.1.73273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]