SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1X2P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1X2P2
Domain Number 1 Region: 314-433
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.17e-29
Family cAMP-binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 174-313
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-25
Family cAMP-binding domain 0.0000565
Further Details:      
 
Domain Number 3 Region: 3-40
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000068
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D1X2P2
Sequence length 453
Comment (tr|A0A0D1X2P2|A0A0D1X2P2_9EURO) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=1016849 OS=Exophiala sideris. GN=PV11_04007 OC=Exophiala.
Sequence
MSLPASYQDLVDALTKDLLNAKPDDPIQYCANFFNRKLESERATSKAPTTKSNGKMADTA
GPFDNRNPFAAKNSIQEEDEEHDTFGSPTDPTFKSRDTGRSPFGGSGFGAAAGGGAAGGL
FGNWLGTQGTEGETEQQHPEQTEQVQGKYAAGRRTSVSAESMQPEADSGNWKPPKHSKTP
DQYERLRHAVAGNFLFSSLDEDSFRLVLEALVEKSIPAQNIKVITQGDEGDYFYIIEEGE
FDIYINPAGSVEAGPEGMGNKVGTIGPGGSFGELALMYNAARAATVVSASKGGLLWALDR
LTFRRILMDNAFQKRKMYEGFLEEVPLLSSLKPYERSKIADALETVKFEAGEKIIIEGEP
GDAFYLLEAGQATAYKDEKPVREYHRGDFFGELALLDDKPRAATVVATNAAKVAKLGRDG
FKRLLGPVESIMRREEYDAGDHLDPLSQHKTVT
Download sequence
Identical sequences A0A0D1X2P2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]