SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1XNU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1XNU3
Domain Number 1 Region: 294-390
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-19
Family Flavin-binding PAS domain 0.00072
Further Details:      
 
Domain Number 2 Region: 155-270
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000000236
Family Regulator of G-protein signaling, RGS 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D1XNU3
Sequence length 602
Comment (tr|A0A0D1XNU3|A0A0D1XNU3_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIV89771.1} KW=Complete proteome; Reference proteome OX=212818 OS=Exophiala mesophila. GN=PV10_07149 OC=Exophiala.
Sequence
MEPPIVPRVRTRLTQDYTSDIEVIRPSPLKGMPQGFIDESSPRTSTSRSQDRNAADLESP
TEARRNFLLSHGAHPTSPIDRNTSGATRSGIGTYFENDSTNTVEELRKLDFSLESAAEDR
SYDSSINTASHATKKPTTTTSHSSATRLPDFFAPQIFQVVLHNPTTAYQLLIFSRSRLAG
ENIEFLRKVEEYGILLDEVAKNMSEIHREYLSVNAPSKINLEDGALLKVNRDLKSALVST
LPTLEVVFNDSQNKMERVVAEDIYPRFVRHQLTASAVRALATDRSNFAGLGDCFVLSDPS
KADNPLVFVSDGFAKVTGYDRREIIPRNCRFLQCQETDRTVVRNIRKALDSCEECVQLLL
NQKKNGEPFWNLLYMTPLFDSRGKVVFFLGGQINCSTTIHSTSDVLRILAMSDEADEEGD
APANPPEVQKHSSRASKILAPFRGRSQLHTPQRAPGMENELLNRIEKEKMTFQRQVDTFY
TAYSKYIVINASTLYISFHSAAIATLLHPAKPSQKADLWTSPQIVGLEIFRFLSVYSKTR
LGSDFKSRVRLAIRAGNAISLDLTLCTKRLMGFEKFASHWTPLKNEVNQVGWVVLTLGSL
ND
Download sequence
Identical sequences A0A0D1XNU3
XP_016221345.1.28705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]