SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1XV79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1XV79
Domain Number 1 Region: 853-984
Classification Level Classification E-value
Superfamily PX domain 8.9e-26
Family PX domain 0.00074
Further Details:      
 
Domain Number 2 Region: 419-563
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.95e-18
Family Regulator of G-protein signaling, RGS 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D1XV79
Sequence length 1231
Comment (tr|A0A0D1XV79|A0A0D1XV79_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KIW06706.1} KW=Complete proteome; Reference proteome OX=253628 OS=Verruconis gallopava. GN=PV09_02405 OC=Sympoventuriaceae; Verruconis.
Sequence
MELKRRDVILAALAVFVAWGYVTHWIPSLRFLPYAFLTGILASVAFQAFLFFSFSRKRER
RGHIKPYPTRNVAFIKPQTWKQEKAELAKRSQYISEPLYMESPVVTQSIDKLIGLILRDF
VNSWYGAISKRPTFTNEVDRTIRAALSNILDRTINLDFVGVGVSRVVPIVTAHMREFYEA
ERTVRGRKLSKSLTESEELDLAIAGKYREGKLHPAASLAFSDTKMAQQGYLRSVVVRLLP
KVLPPSMTTSRAVMVLIQEIVTCAVLFPVVTILADPDTWNQLIANSGRTILQERKTVKKL
RAALDEHASTSPKTVRTVPFPRLAPGDSERMFERFIRAIRKCNTIADARRFRSEVASQLH
RESAVAGQDPIYLRRLETGKRALDQRIAQLGASGNVKPARGALPPSEDSFRFSASRAETM
TLREVLYSATGLSYFMEYMDRVHLMKLVQFWIVVDGFRNPLEDDADESIEVTDSARVWTD
SERNDIAQINEAYLSLPEIKISPLSREAIRNFLKSGSQATNAQYYAARKAILRAQTAAYE
DMLEPHFSNFKKSDLWYKLLAAEEAASVPSRQQFSTQAPTAQGGRRSLDGERAAKSSRLL
AAPSKVKAPDLRRQVASASDLKGYVKADSDGESPVRKSLDNGRKPLFDDDLDSDPLANSI
ASLDSDHEPAVQNGDNAQIIDAMQEALNDIMDEPLDKDSIFSEPSMKSPLETDSMRSSME
ITRPASPAVNPPKKGKPSVASLGLLGTPGKKGVFDEDLFAEEQPKFIEDEHEDSAGSEKD
DEDAIVEAAPGDLGLAEAIDALTLDIEKLVTQESIVDSLTKKAELTNNAAELRILRKSKA
SLQREINRKELQRQQFIIQESDNSLYGRATIAIQSVMVGKDEDGKEYAVYVIEVRRQAGD
QMPAASWVVTRRYSEFHELNKRLRSRFPMVRNLEFPRRQIGLKLQRDFLQKRRAALEKYM
QELLKVPAICRSREFRAFLSQHALPSASPASTQVDQKDFVSRIYSSVTDGMEEFLGNIPV
LDQLSLAGQNLISAATTQLSATQANPSPATHSSPASEELAASAEAEAELRAFETRELEPF
VKPICDLFLETFELNRENNWLRGRAVVIVLQQLLGGTIERKVRESAKGYLSDEGVAKYIN
MVIDAMWPGGVKRAEGVPRTQTEKTRSRQEAAVVLASLIPEFVGSVVGRANAQAAARRIL
AVVNNQRLLTHLVFTLLDEIVQIVFGDGVMR
Download sequence
Identical sequences A0A0D1XV79
XP_016216575.1.69129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]