SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1YT96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1YT96
Domain Number 1 Region: 285-383
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.89e-19
Family Flavin-binding PAS domain 0.0003
Further Details:      
 
Domain Number 2 Region: 150-264
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.5e-16
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D1YT96
Sequence length 591
Comment (tr|A0A0D1YT96|A0A0D1YT96_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIV85847.1} KW=Complete proteome; Reference proteome OX=1016849 OS=Exophiala sideris. GN=PV11_01501 OC=Exophiala.
Sequence
MEPPAIPYNPHNRLFRDFTGEPTSNSVASRRQMGLHAPLGSPVRRPSYEARADSARSAEG
RTSSFRSQRTKSPTVGELHEARGLHSELASPAEKSDYDDLQKLDFNLGAIDEGNSSAASV
NSISRASQATGATSTSKSSRLPDFFAHEVFQTVLHNPTTSHQLLKYSQSRLAGENLEFLE
KVDRYNALLNDVANNMFEIHRDFISVNAANQINIPDSILIKVNKDLKAALATTLPRLESV
FVDAQNDIERLVAMDIYPRFVRHQMTMSAAKALASNRGKYAGLGDCFVLTDPAKADNPIV
FASDGFVKVTGYERNEIIPRNCRFLQNRHTDKSAVGRLRDAIAKREESVELLLNQRKTGE
PFWNLLYTAPLFDAHGNVVFFIGGQINCSTTVHNQSDVLRILAMSNDTDEKAANGAISPP
PVEQKQRPRASRLFSSFRSKQITEPQGPPGMEEAMINKLEKMNLKKQMDTFYTAYSKYIV
INYSTFYISFYSAGIATMLYPTKPVPKNTVSQIVGMDIFRFLEAHAKSKLGSEFKQRVRT
SLKMGHATSMDVTLCTRRHMGFERFATHWTPLKNEAHEVGFVILTLGSYQD
Download sequence
Identical sequences A0A0D1YT96

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]