SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1YWX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1YWX8
Domain Number 1 Region: 325-472
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.57e-28
Family Regulator of G-protein signaling, RGS 0.00092
Further Details:      
 
Domain Number 2 Region: 191-297
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.8e-25
Family DEP domain 0.021
Further Details:      
 
Domain Number 3 Region: 17-141
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000322
Family Rps19E-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D1YWX8
Sequence length 489
Comment (tr|A0A0D1YWX8|A0A0D1YWX8_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KIW05232.1} KW=Complete proteome; Reference proteome OX=253628 OS=Verruconis gallopava. GN=PV09_03770 OC=Sympoventuriaceae; Verruconis.
Sequence
MHQTSSRLLRMTDDDRPFTRDFKDLFSTLMVSLPLTPHRVRFAKIDHTFTSEEAVTNLGS
LKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKEMARSVCQKFLEARFVESADGKNDFTSKS
AVWQLTPKGMHILQRFCQRNGIQQRHVFELLNSSRNTMNLVILEREPETDKLHRDQATVE
VVFRRFVGTEPNVKNSISSSDSDSLSEYQTGLVGVKMAKERKVGDRVYYNTFTGKAVVDW
LMDCCTMVDRRETIELAQLFCDHGLIACVDNPNSARFSQSKSSIYTVTEKGQRVAGWVTS
SKSSGNPDAHVNGSRAREGPTRDSNTNRMTVILQDPALRLLFREFLRDTHCEENLAFYLD
VRDFLANYNAAKRQQTVPKLEIIRETLAAAYGLYNAFLAPGSPCELNIDHSLRTSLAARM
TRAVDDDDAMVKSLDEVATLFDQAQNSVFKLMASDSVPKFLREPKYANILRERNLDGQVA
VTNGRAVSG
Download sequence
Identical sequences A0A0D1YWX8
XP_016215101.1.69129 XP_016215102.1.69129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]