SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1Z6M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1Z6M8
Domain Number 1 Region: 483-637
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.27e-25
Family Regulator of G-protein signaling, RGS 0.001
Further Details:      
 
Domain Number 2 Region: 352-466
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.99e-21
Family DEP domain 0.013
Further Details:      
 
Domain Number 3 Region: 177-302
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000612
Family PadR-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D1Z6M8
Sequence length 666
Comment (tr|A0A0D1Z6M8|A0A0D1Z6M8_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIV89519.1} KW=Complete proteome; Reference proteome OX=212818 OS=Exophiala mesophila. GN=PV10_06912 OC=Exophiala.
Sequence
MFRLSNGHIYDSMTSPDPHLSAHSVAEHTSSPGHSSNREVSRPPNHSHSNSTSLVHTKSR
RSLASLAREKTSNAFANLTAIASPSSPALRSATSSSSLSKQPSYTTSRPSLSRSPTSPAD
LPNTSLSQSRRVSGVAQTPQEPRSSTTVPPMPTTDKNNGRMHQTSSKILRMTDDERPFTR
DFKDLFSTLITSLPLTPHRVRFTRVEETFLSEEAITNLGSLKFSQSNRIPDPKNPTRWVV
TTTTTTFSMAKEMARSVCQRFVDARMIESAESKTNTTFVTKGAVWQLTPKGVAILQRFCG
RNGINARHIEPLLKRSPMQIVALERDATTDKLVQDRATVEIIFRRFMGFEGPNLKSSTSL
SDSDSVSDYASGMVGVKMAKERRVLDKNVANTFTGKAASDWLLDCCTTIDRRETYEMAEL
FVKWQLIQPVVEDRSYVRMNPMATYFQPTKFAIYTPTERGQRVCGWIARPPSVNSEDSRD
TKDKSRSVRDSNVSRLNVILQDAALRLLFREFLRQSLCEENLQFYFDVHDFTTSYRSLEQ
GGKLDRPDSVRETLAAAYGLYNSFLASGAPSELNIDHSLRNRLDSRMIRTNTDDDSMRES
LADVVELFELAQAAVFKLMASDSVPKFLRDPKHASVLREHDVDLIGGTRALSPATDRLSR
SNTGRG
Download sequence
Identical sequences A0A0D1Z6M8
XP_016221093.1.28705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]