SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D1ZA45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D1ZA45
Domain Number 1 Region: 55-102,192-262
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000589
Family Regulator of G-protein signaling, RGS 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D1ZA45
Sequence length 421
Comment (tr|A0A0D1ZA45|A0A0D1ZA45_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIV83648.1} KW=Complete proteome; Reference proteome OX=1016849 OS=Exophiala sideris. GN=PV11_05652 OC=Exophiala.
Sequence
MSPSLLSWLHWYRKPSYLDPVIFSKSANADIEQGLGSGSGSRPSSVSSQSDTAIPADLSL
DRVLANKTCSPLSLYDFYMYLKHIEMSPENLEFYIWFKDYEARYQQQSHPGLPSQMTPLL
VAPTGEKSATYSYAGAMTESELDDEKPGSGSESELQQYIESLVAATQETRPCRNSTSLFW
PRPSPASDRTLTARPFSNHAELSHVSALFLTPSSRKELNIPPSMREKALDAIATSDSPEH
LAPVANHVYYLLRNCSHRNFIRLGVKNGTFETLCMVTIVGCLFTALGLLTMLLVAFASPS
IHHSSRWRGLASVPFWMIGFSFLFAGWRGSCFLLLLFSRRQELPWERLEDNASTKSGRSA
RLQQLWLVRFAKKLMIFERKIRVKDQGLRHLQRKIVVQSVVAAVIVTAVLEVVWLVLPIW
K
Download sequence
Identical sequences A0A0D1ZA45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]