SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2BCS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2BCS5
Domain Number 1 Region: 136-223,288-344
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.08e-17
Family SMI1/KNR4-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2BCS5
Sequence length 566
Comment (tr|A0A0D2BCS5|A0A0D2BCS5_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KIW09209.1} KW=Complete proteome; Reference proteome OX=253628 OS=Verruconis gallopava. GN=PV09_00137 OC=Sympoventuriaceae; Verruconis.
Sequence
MASVGSMFKDFWQALVSNDRHASHDSPYRTGQHVPLPQSRHAPLTSIATSAIESRTDLHE
AIPQSSSASVNGHTSPNNGRMSPSSPYSPGMRSAMRRQSSERSSTRGSIEKQPATEIQMQ
NFNDGLPPPPPVAHSWKRIDRWVRDNYAELYENLCEGATNNDINELEHQLDCTLPLDVRE
SLMVHDGQEHGGRPTGIFFGCMLLDCEEIYDEWCNWRAVNEQYLAQRAEDMLPAAIPVKA
FAGASSSSSSVVPTIERQSASGALWREQLQERQQSQPPNAVQRVYTHPAWIPLARDWGGN
LIAVDLAPGPMGKWGQVILCGRDYDTKFVVARSWAVFLANVADDFSAGDKIIVDEENNEL
RFKPFKNADPPYMEILRWRCDQKYGRRPSTQARRGPGRGGLKINSSVGSGAFMSDSSPYA
SPISATSDKERGRSPHRFGGKAPVGSSPLRPMISSPLARVTEEASSPLTIETNSETLKQA
TPPNPVDSKLVSVDTPRQSGELPEATSTSAPEANGTLTAKNKENESVGTKSAADNTSEKA
SAASERKTSKVDSGIGDMGDMKTVEI
Download sequence
Identical sequences A0A0D2BCS5
XP_016219078.1.69129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]