SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2BJB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2BJB9
Domain Number 1 Region: 61-198
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.65e-20
Family Regulator of G-protein signaling, RGS 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2BJB9
Sequence length 373
Comment (tr|A0A0D2BJB9|A0A0D2BJB9_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIW52501.1} KW=Complete proteome; Reference proteome OX=348802 OS=Exophiala xenobiotica. GN=PV05_08133 OC=Exophiala.
Sequence
MIRKKPLTIKAWPFTPEPSPRLEPAVYYLDDISEELDMSGDELPRARPISMVSRREGIMS
PGRPTLEDVLNNKAPSPYTLAAYTAFLSQQHCLETLEFTTEAKRYADKYDEACASLAGMP
MTVDTTEGWELIQDWTRILDIYVKPGAPREINLPAEERDGIVQVPYELKPPRPETLDPAV
KRMYDLMSDSIFIPFCNSLKQLPYAQTYNTMSEYTGYGDFEPSRLTFDERTLHHQISRRR
RSPPNTSDASFQPSRSPPQQHNRSSTLSSALGRQSGNRLSTHVSHSSAVSESALTDSSGG
PESPSAGEHDSSITPPTTPPTSDLGLAGTSHGSSGMSFHPTKSHRSESGGGWKKAMKMFS
GGKRKNGSFHETD
Download sequence
Identical sequences A0A0D2BJB9
XP_013313085.1.29456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]