SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2BV01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2BV01
Domain Number 1 Region: 9-60,186-268
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.84e-23
Family Regulator of G-protein signaling, RGS 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2BV01
Sequence length 382
Comment (tr|A0A0D2BV01|A0A0D2BV01_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIW15034.1} KW=Complete proteome; Reference proteome OX=91928 OS=Exophiala spinifera. GN=PV08_07821 OC=Exophiala.
Sequence
MAHDTSPEQELEQRNRLPTLMEVLGRRTLAPVDLFSFYIYMRDQQRSVDYLDFWLDVSQH
MSLCRHYVRELRRSMLVDTPEMEKATSKRSSALLGDFDLGEGMDTRKSGQESRVSAILRG
DNGTRTKPTSRGRGGSYDHSPAHSMGSSHSRNYSRPSGDRQSLSEQLPQPSYAATEVRTD
SNSPGHSVARADIKASAEKILYTFVLPGSEREIVLPDSMLNKIIRAIEEEGRDDPEVFDD
AKDYVFQAMERDAFPGFLQAKALGNLVPLSVLIRLIIGLSSLMAGFWGGYYMILRNISRS
TRCWLILPFVIGSYFLVSYQYKLDIITAYLGFSEYTWMNWSRVREPFVRRLLLTRATMAF
FMFAAVAVGLSVLFIFVPGTNF
Download sequence
Identical sequences A0A0D2BV01
XP_016235250.1.41232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]