SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2C2L3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2C2L3
Domain Number 1 Region: 383-496
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000196
Family Pseudo ankyrin repeat 0.029
Further Details:      
 
Domain Number 2 Region: 59-171
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000164
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2C2L3
Sequence length 582
Comment (tr|A0A0D2C2L3|A0A0D2C2L3_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIW24735.1} KW=Complete proteome; Reference proteome OX=569365 OS=Cladophialophora immunda. GN=PV07_10430 OC=Cladophialophora.
Sequence
MERPVQPRPIRRRVNALLYVSQRIGPELLPYLLHNPNLNLRVISELSKSEFQQHMAPGVS
LDNVQWIENKPQDPHRNEVMMLGHRLARWADFMFLAIDAGMICFMLSGFTTDVLLHALRC
WDVSKRIDLLPELSRDQYRHPIWNRQLSELRRKWDWVRVLSPAIFEYSENGTSLAQSGAN
SLDGDVTPEFRWSWAGPSEMIEAIESETQSVLRATCLKTNSAFPDLPLSKTTSSKPQLPS
EIWTIILDHLGDWELATALGIFTHLPVPHEWEPLIPQPGSSKSPSLEYTILTQPVGQVQK
YFTNNASSNPPTTLSPIATRLIFRFSMTGLLTYLALQQKDIFWTSFGLALLPHKASLIYN
SPTILQWWKDCPAVIKKEYGPEALDGASRAGFVEVLDWWLNSGLKLTYTEKALESASAKG
HVEVLEWWKENSQKLAGTDREMPLKVGKSILLAAQSGRTNSIEWWETSGIPYAHEDGVAR
LASQHGHVPVLELWYRFKGSKMIFDNQVLVGATKNGHAGVLQWWKEISRKTGLRVEYKTC
DIEEAMEDAVGGGGEGEVREWWARNGLNLGVGTGEWMRVKTL
Download sequence
Identical sequences A0A0D2C2L3
XP_016244951.1.39546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]