SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2CNL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2CNL6
Domain Number 1 Region: 288-386
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.74e-18
Family Flavin-binding PAS domain 0.00035
Further Details:      
 
Domain Number 2 Region: 151-266
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000028
Family Regulator of G-protein signaling, RGS 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2CNL6
Sequence length 627
Comment (tr|A0A0D2CNL6|A0A0D2CNL6_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIW66816.1} KW=Complete proteome; Reference proteome OX=5601 OS=Phialophora americana. GN=PV04_06110 OC=Phialophora.
Sequence
MESPVVRFSPRSRLTRDYTLDDHITSGRPSKGAMSLGPDFSLPLQRPSLEIQSDAIKSTD
SRNSGKREYVTGTPLGRQAAEPCDCESPTSNGQNGDKENRDQLRKLDFNLEAIDEMSSYE
PSVTDTVSRASQHTNLTTTSASRLPDFFAPEVFQVVLHNPTTSHQLLKFSQSRLCGENMA
FLDKVDKYNSLLNEVAKSMFEIHRDFISVNADNQINIPETLLIKVNRDLKTALASTLPKL
ETVFVDSQNEIERLVAMDIYPRFVRHQMTVSASKALAGDRAKYAGLGDCFVLTDPAKADN
PIVYASDGFVRVTGYARNEIIPRNCRFLQCRNTDMSAVKRLREAVHARQESVELLLNQKK
SGEPFWNLLYTTPLFDATGNVVFFLGGQINCSTTIHSTSDVLKVLAQTNETDKNPVDGLM
SPEASKNSSSLRTKFKNPFRSKTMLEPHRQPGMEDGLLNKIEKMNLRKQMDAFYSAYSKY
LIINHTTFYISFHSPGITTMLYPTKPRAQPVPQNHSTHTLSKSRSHPHPNSVLGSGPGTG
SSADLAGQIVGMDIFRFLATHSAASKLGSDFKTRVRAALKSGKPISLDLVLCTRRYLGFE
KFVSHWTPLKNEVGEVGWVVVTLGARE
Download sequence
Identical sequences A0A0D2CNL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]