SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2CVF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2CVF7
Domain Number 1 Region: 319-440
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-30
Family cAMP-binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 179-318
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.24e-25
Family cAMP-binding domain 0.0000378
Further Details:      
 
Domain Number 3 Region: 3-40
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000034
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2CVF7
Sequence length 457
Comment (tr|A0A0D2CVF7|A0A0D2CVF7_9EURO) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=348802 OS=Exophiala xenobiotica. GN=PV05_06453 OC=Exophiala.
Sequence
MSLPTSYQAVIDALTKDLLSDKPEDPLQYCANYFTRQLESERATSRSSQSTTSANGKMTD
TAGPFDRNPFAAKNVNSIQEEDEERDNFGSPTDATFKSRDSGRSPFGGSGFGAAGGGGGG
GGAAAGGTLFGNWLGTQGAGETGEQPTEPATGKYAAGRRTSVSAESMQPDADSGNWKPPK
HSKTPDQFERLKHAVAGNFLFSSLDEESFHLVLDALVEKSIPAANIKVITQGDEGDFFYV
IESGDFDIYINPSGSVEAGAEGMGNKVGTIGPGGSFGELALMYNAPRAATIVSASKGGLL
WALDRLTFRRILMDNAFQKRKMYEGFLEEVPLLASLKPYERSKIADALETVKYGAGDKII
TEGEPGDAFYLLESGEAAAFKQGIDNPVKEYHRGDFFGELALLDDKPRAATVVAKTPVKV
AKLGRDGFKRLLGPVESIMRREEYDAGDPLSQQKTVT
Download sequence
Identical sequences A0A0D2CVF7
XP_013314646.1.29456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]