SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2DFR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2DFR6
Domain Number 1 Region: 89-321
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.62e-49
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 409-713
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.01e-44
Family Ankyrin repeat 0.0000754
Further Details:      
 
Domain Number 3 Region: 304-433
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000116
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2DFR6
Sequence length 802
Comment (tr|A0A0D2DFR6|A0A0D2DFR6_9EURO) Unplaced genomic scaffold supercont1.7, whole genome shotgun sequence {ECO:0000313|EMBL:KIW76526.1} KW=Complete proteome; Reference proteome OX=1442368 OS=Fonsecaea pedrosoi CBS 271.37. GN=Z517_11272 OC=Fonsecaea.
Sequence
MGGRTLVTCPACRKENTSTVRLFPSNAIRATIRESTSSSLGTGVRNASESSRNRLSTRIP
PATIETSPTLPSKPTVAYEDAMKSALAQTSVLTDVCGKGAENRVFHLLERGAKVNEPPAE
EGGRTPLQAAAEGGHLKTVEILLAHGADVNGAAAPFNGMSALAAAADRGHVEVVKMLLAR
GAHVNAVLPGWRDYSSALQYACKAGHTEIIRSLLEAGAEPNNNKWKSASPLCLAAEHGFL
EAVQLLLEYGAEVDNAASLELDHGRPRGTTPLHEATTKQHKEVVDLLLRHGADPAIVDAG
QSSPLHIAAAFADQAIFQLLLASPRIHKFVEMRDKYKAALMQTICKDGSFDRIKYFLARV
PGPRDHFPLKCWAVFFCCGLGYTKTVEGLLDLNLSPNFSVSSDATRLVGYQAETSLEHAI
LKGHTEVVELLLKRGAIVSSSGGFRLSKENPILTAASKGFLDILKLLLANGVSFDQGLQS
EAMQKAAKNGHTAVVEFIISSHQQSADKSEMNKSLHKALAGGDTPTSRFLLVSGADANCE
HEGRRPLHLACFSAEIVELLLAHGADVGAEDEKKNLPLHKAAFARNKDAPRIVQLLLQAG
SAIDQKNATLDTPLMTACAARNVEVIKELVLAGADARATDAEGRTPLHLCCARDGDHNAD
QHEAIRVLASLLWVDVDAEDDKGRTPLDLAAQSFRSPVVRTLLDVGADPELVDLERLRHG
IVVAHEPRATIYECEAVWQIRKARGQTESLYGDELPVGFKRVRRLDSTDKGGSMKQVSED
GTVDSFVFDMAVLNAISSFRDL
Download sequence
Identical sequences A0A0D2DFR6
XP_013280334.1.45204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]