SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2DS99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2DS99
Domain Number 1 Region: 40-89,209-280
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000162
Family Regulator of G-protein signaling, RGS 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2DS99
Sequence length 451
Comment (tr|A0A0D2DS99|A0A0D2DS99_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIW65027.1} KW=Complete proteome; Reference proteome OX=5601 OS=Phialophora americana. GN=PV04_07317 OC=Phialophora.
Sequence
MVLSLSYRRPAYVSSSRDSIESEKSGRVESINSNTSCPYGIPDALSFDRIISGATCPPVT
TREFMDFLRYIEFDAENLQFYLWYKDYCKRFDGLAESQRKLAPEWTIEQALAEKNAAEKE
KLPKKIASQAAAVLKGTDFDPSARAGIPEPAPNPFNTPPRTPSASAADHDSMVPSTIGYS
DDATTLRSGTIDHSKRTAAAFEEAGALQPFTVQPFREEISRIIATYIAEGGARVLNLSAK
EKAVLLKALSVTTHPSAFRDVIATVEWSLRHQAHPNFIRWTICNGNKPRQAFARFLGVAG
IVGGIVYAIVITLSSANRGWRALAFLGLFIGVATLFAAWKGMCVVLHGMHHRHLRPWELF
GDEDQSSSDYMSQKESFDSFGSSNSYEDEPWVAKYEKRNLIRKIFDREVWIQEPALRQIQ
DTIFVQALLTALTVGAITTAIFLAVPRGNFF
Download sequence
Identical sequences A0A0D2DS99

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]