SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2E2Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2E2Z9
Domain Number 1 Region: 26-170
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00000000000719
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.001
Further Details:      
 
Domain Number 2 Region: 382-495
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000275
Family Pseudo ankyrin repeat 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2E2Z9
Sequence length 581
Comment (tr|A0A0D2E2Z9|A0A0D2E2Z9_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIW49120.1} KW=Complete proteome; Reference proteome OX=348802 OS=Exophiala xenobiotica. GN=PV05_10829 OC=Exophiala.
Sequence
MGLPPKSGYNRTRVNALVFVTSKIGPEVLPYLMQNPDLNLRVISDSPKAEFQSYMSPGVS
LDRVQWFENTPQDPYRNQAMMQGHRLARWADLMFIVLDAGMISLMLSGFTTDIILHVLRC
WDVSKRIALLPELSVDQWKHPTWKKQLSKLARRWDWVHVLSPALWDYAENPHNYTQPGPN
PLGKDSEPEIEWQWDGPEEIIEAIESEAQTILRSTFISKSSMPHLSPIHSGSSKPRLPSE
IWTIILDHLGDWELATALGIYTHIPTPHEWESLTPKPGSKKVPSLEYTILTQPVSQIKTY
FTNNTSSQPPTTLSPIATRLIFRFSMTDLLTYLALQQKDIFWTSFGLALLPHKASLIYNS
PTILQWWKDCPAVIKKEYGPEAMDGASRAGFVEVLDWWLDSGLRLTYTEKALESASAKGH
VEVLEWWRVNSLKLAGTPREMPLKVGKSILLAAQSGRTNSIEWWENSGIPYAHEDGVARL
ASAHGHVGVLELWHSYKGSKMIFDNQVLVGATKNGHAGVLQWWKDVSRKTGLRVEYKTCD
IEEAMEDAVGGGGEGEVREWWGRNGLNLGVGTGEWMRVKSL
Download sequence
Identical sequences A0A0D2E2Z9
XP_013309704.1.29456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]