SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2E7I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2E7I7
Domain Number 1 Region: 39-87,205-276
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000183
Family Regulator of G-protein signaling, RGS 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2E7I7
Sequence length 447
Comment (tr|A0A0D2E7I7|A0A0D2E7I7_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIW51418.1} KW=Complete proteome; Reference proteome OX=348802 OS=Exophiala xenobiotica. GN=PV05_10139 OC=Exophiala.
Sequence
MVLSLSYRRPAYVSSSRTSLDSEKPTESISSGSSCQYGIPDALSFDKIISGGTCPPVTTR
EFMDFLRYIEHDAENLQFYLWHRDYCKRFAELPVSEQKLSPEWTAEQALAERTNAEKEKL
PRKVANSAAAVLKGTDFDPNAKLGAPESVPNPFNTPPRTPSATDRESVAPSTVGYSEDGT
TLRTGVTNHSKKAEAAFEEAGTLQPFTIQPFREEISRIIAIYIADPSSRMLNLSSKERAV
VLKALSVTTHPSAFRDVIATVEWSLRRQAHPNFIRWTICNGNKPRQTFARGLGVAGIVAG
IVYAIVITLSSANRGWRALAFLGLFIGIATLFAAWKGMCVVLHGMHHRHLRPWELFNDDD
EASSDYTLNKGSFDSLGSSNSYEDSPWVAKYEKRNIIRKIFDREVWIQEPALRQIQDTIF
IQAILTSFVISAIITAIFLAVPRGNYF
Download sequence
Identical sequences A0A0D2E7I7
XP_013312002.1.29456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]