SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2E7Z8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2E7Z8
Domain Number 1 Region: 128-215,268-334
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.76e-18
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2E7Z8
Sequence length 546
Comment (tr|A0A0D2E7Z8|A0A0D2E7Z8_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIW51543.1} KW=Complete proteome; Reference proteome OX=348802 OS=Exophiala xenobiotica. GN=PV05_10253 OC=Exophiala.
Sequence
MANSFASAWRSFWHTMTSNDRHASHDSPYRTGQHVPVSQSRHAPLTSVATSAADSHQDLP
ATYHDDSKRPSISSSQLAGSPARPYSPGMRSISSPKAPQVEESVAPGEIQMQNFADGAPP
PPPVSHSWKKIDRWAENHYEELWDQLGEGCTQNDVNELEHELDMTLPQDVRESLSIHDGQ
ERGGRPTGIIFGCMLLDCEEIVQEWKNWKVVNEEYLSGAKSKYSSKGLSNGSSSSSQTQN
GNRFWRQELLDRQESQPPKAIQKAYAHPSWIPLARDWGGNNIAVDLAPGPMGKWGQIILF
GRDYDCKYVVARSWAHFLATVADDIGSEKVFVDEDTGELKLKEFKTEAVEPPYMDILRWR
ADQRYGRRGPKRRPQPASLNTSSVAQNGRQSPYSSPVIGGEDRGRSPQRFSRGPQGSPRH
AVGSPLARVQEEIAQPQPVRPGGDVVRDFAESADSLSEGKKREKLVEGPTPLDLKISNLP
RKPEKLVDAPTPSSLKSADSDKFPATRLARVFTEPEIKEEKPDQEKAEVTGLGVNGIEDE
MKTVSI
Download sequence
Identical sequences A0A0D2E7Z8
XP_013312127.1.29456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]