SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2EP09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2EP09
Domain Number 1 Region: 89-164
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.02e-31
Family Skp1 dimerisation domain-like 0.0000269
Further Details:      
 
Domain Number 2 Region: 8-73
Classification Level Classification E-value
Superfamily POZ domain 9.16e-21
Family BTB/POZ domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2EP09
Sequence length 166
Comment (tr|A0A0D2EP09|A0A0D2EP09_9EURO) Unplaced genomic scaffold supercont1.7, whole genome shotgun sequence {ECO:0000313|EMBL:KIW76112.1} KW=Complete proteome; Reference proteome OX=1442368 OS=Fonsecaea pedrosoi CBS 271.37. GN=Z517_10857 OC=Fonsecaea.
Sequence
MSSDNSKKLVLQSSDGEDIVVDRDVAERSILIKNMVGDLGEDAMEEAIPIPNVNAAVLKK
VIEWCTHHKHDPPATNEDDSDSRKKTTDIDEWDQKFMQVDQEMLFEIILAANYLDIKALL
DVGCKTVANMIKGKSPEEIRKTFNIQNDFTPEEEDQIRRENEWAEE
Download sequence
Identical sequences A0A0D2EP09 A0A0D2K197 A0A177FFG1 A0A178CMK4
XP_013279920.1.45204 XP_016630917.1.52555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]