SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2FFU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2FFU7
Domain Number 1 Region: 853-985
Classification Level Classification E-value
Superfamily PX domain 1.57e-25
Family PX domain 0.00095
Further Details:      
 
Domain Number 2 Region: 415-558
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-18
Family Regulator of G-protein signaling, RGS 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2FFU7
Sequence length 1226
Comment (tr|A0A0D2FFU7|A0A0D2FFU7_9EURO) Unplaced genomic scaffold supercont1.1, whole genome shotgun sequence {ECO:0000313|EMBL:KIW85562.1} KW=Complete proteome; Reference proteome OX=1442368 OS=Fonsecaea pedrosoi CBS 271.37. GN=Z517_00954 OC=Fonsecaea.
Sequence
MNLTQRHVLSAAIAAFIAWGLAVRALPVLRFLGYAFTLGSLVTLVTLLAVTLSVSRSRPA
CQSLSSPPNVSPAFLLPPKWDPEISVLRVSQQYQPLHLYDQSFVVSQALEALIGLALRDF
VSSWYQNISKSPTFVNEVDRNIRAALVEIRDRILAEDIVNVLVSKIVPLITAHLRDFDQA
ERAVRGRSLNRNVTESEELELAIAAKYKDGKLHPAAALTYSDTKTVQQEHLRKTLVRILP
DLLSPSMMGSRATLVLVKEIVAGAVLFPIMQLLSDPDTWNQIVEAYGRTALQDRKTVRRM
RAALDQHASPVPRNRPGQELPRLAPNDSERAFERFVRAIRKTKNLSDARRFRNSVVSQIQ
RESLVEGQDPVYLRRLEMAKRVLDQKIAKLTQTGPVPPAALPQLDSRPIPASKPREWSMV
EIMHTASGLSYFMEYMDRQNRMSLVQFWVVVDGFRNPLEDDFGDELNPGIQQSWTDADRM
DIAQISEKYMLKEELNIPQESRDAIKAFLAAGRKATPQQYRAARTAILAAQSAVLEELET
RHLPNFRKSDLYYKFLASAEAAAARPRQQSTGNLAEGNGQVGAETTRAPTQAMTRSSSQL
AIRNKDLRRAAVSSSDVRSLASSKLFEDGDLAKRSSGSTPLFDDGYDTDPLAHSTNSLGH
ESLNGESLDQRQVIENMEAAMNNIMTDSPMDETMGYDDDTLFGSPVSVTKSSKNFDSPRS
SLDIPSSEQANKPKPSLATLGLVNTSSRIGVFTDNDLFPDEEKFIEDEYVDNDDSKGDGV
DEDEIHEAAPGDLGLAEAITALNNDIERLVAQESVVDTLTRKAELTNNVAELRILNKSKS
SLQREIRRKELQRQQYIVQESDNSLYGRSSISIKSVVVGKEDDGREFALYVIEVQRQAGD
QMPAAAWAIPRRYSEFHELHQRLRRRYPSTRNLEFPRRRVVMKLQKQFLQNRRLALEHYL
QQLLQMPDVCRSRELRSFLSQSSIKSHQDTSKESNAQDIVTRIYNSVTEGMDEFLGNVSV
LDQLSVAGQNLISAATNQLGMNQADIVPLEPGPVAEAEAELAAFEDKELEPFVKPICDIF
LETFELNRGNNWLRGRAVIVVLHQLLGGTVERKIREIFAGFVQEESLLKYIDMMKETMWP
GGGKLRETKPRTGAEKKKSKSEAALMLATLIPDLAGNVVGRANAQAAARRITATMNNARL
NQHLVFTILDEIVAVLFDPAKKGSLS
Download sequence
Identical sequences A0A0D2FFU7
XP_013289370.1.45204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]