SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2G0S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2G0S4
Domain Number 1 Region: 852-983
Classification Level Classification E-value
Superfamily PX domain 5.36e-25
Family PX domain 0.00085
Further Details:      
 
Domain Number 2 Region: 411-558
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.06e-17
Family Regulator of G-protein signaling, RGS 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2G0S4
Sequence length 1224
Comment (tr|A0A0D2G0S4|A0A0D2G0S4_9EURO) Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.2, whole genome shotgun sequence {ECO:0000313|EMBL:KIX08107.1} KW=Complete proteome; Reference proteome OX=1442369 OS=Rhinocladiella mackenziei CBS 650.93. GN=Z518_02763 OC=Rhinocladiella.
Sequence
MNLAQKHVLFAAFAAFVAWGFAVRWLPVLRFLGYAFTGGCLITLVALLAAILTVTRSRAR
YHHAHALPAASPAFLLPPKWRSELSILQASRQYKPIQLYDQSFVVSEALDTLLGLALRDF
VSSWYGTITKSPVFVNEVDKNIRAALAEIRDRILNEDMVNVVVSKIVPIITTHLRDFDQA
ERAVRGRSLNRSVTESEELELAIAAKYKDGKLHPAASLAYSDTKIIQQDHLRKVLVRILP
DVLSPNTIGSRASLVLVKEIVSGAVLLPTMQLLADPDTWNQIVEAYGRTALQDRKTVRRM
RAALDQHASPVPRIKPDQESPRLAPNDSERAFERFVRAIRKTKNLSDARRFRNSIASQIQ
RESMVEGQDPVYLRRLEMAKRVLDQKITKLSRTRAVPQAPQPDSRPGPTAKPHEWTMVEI
MHTASGLSYFMEYMDRLHRMSLVQFWVVVDGFRNPLEDDFGDELNPALQQSWTDADRMDI
AQISETYMLKAELNIPQESKDAIKSFLAAGRKATPQQYRAARTAILSAQSAVLEELETRH
LPNFRKSDLYYKFLASGEASAMRPRLQSADSILEMNDSALATAPKAPTQAPAMTRTNSQT
GARAKDLKRAAVSSSDVRSLASSKLFDDGDFAKRGPSAPLFDDGYDTDPLAHSTHSLGHE
SLNGDSVEQRQVIESMEAAMNNIMTDSPMEDSMSYDDDALFGSPTSGSRSTKTMESPRSS
LDFQSMDTANKPKPSLATLGLVNTSSRIGVFSDNDLFPDEEKFIEDEYVDNDETKENDVD
EDAIHEAAPGDLGLAEAITALNNDIERLVSQESVVDALTRKAELTNNVAELRILSKSKSS
LQREIRRKELQRQQYIVQESDNSLYGRSSISIKSVVVGKEDDGREFALYVIEVQRQAGDQ
MPAALWAVPRRYSEFHDLHQKLRRRYPSTRSLEFPRRRVVMKLQKQFLQNRRQALEHYLQ
QLLRMPDVCRSWELRSFLSQQSITSHQRANSASDAQDIVTRIYNSVTDGMDEFLGNVSVL
DQLSVAGQNLISAATNQLGIHQGDIVPMDPGPIAEAEAELSAFEDKELEPFVKPICDIFL
ETFELNRGNNWLRGRAVIVVLHQLLGGTIERKVREIVKSFTQEDALLKYIDLIKETMWPG
GGKMREVQPRTAAEKKKSKSEASMMLATLVPDLAANVVGRANAQAAARRISATMNNARLN
QHLLFTILDELIGVLFDPSKKGFG
Download sequence
Identical sequences A0A0D2G0S4
XP_013275243.1.10589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]