SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2G4H6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2G4H6
Domain Number 1 Region: 500-642
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.9e-25
Family Regulator of G-protein signaling, RGS 0.0011
Further Details:      
 
Domain Number 2 Region: 357-471
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.32e-22
Family DEP domain 0.014
Further Details:      
 
Domain Number 3 Region: 182-306
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000021
Family Rio2 serine protein kinase N-terminal domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2G4H6
Sequence length 672
Comment (tr|A0A0D2G4H6|A0A0D2G4H6_9EURO) Uncharacterized protein {ECO:0000313|EMBL:KIW66954.1} KW=Complete proteome; Reference proteome OX=5601 OS=Phialophora americana. GN=PV04_06234 OC=Phialophora.
Sequence
MSEPNDVTVDEPMTSATPPNLLAQVVSSGTAQDSPTISTSSRTDFIRTPHHHHSGSTSLT
QSKSRRSLASLAREKTSSAFANLASLGTSSTPSLRSATSSGSLSKQTATPGGLRPTLPRS
PTSPEVHAAAQSRRTSGVPVLASQDLRNSIATAPSMPNPDRKDGKMHQTSSKILRMTDDE
RPFTRDFQDLFATLITSLPLTPHRVRFSRVEETFLSEEAITNLGSLKFSQSNRIPDPKNP
SRWVVTTTTTTFSMAKEMARSVCQRFVDARLIESAESKANTAFVTKGGVWQLTPKGSATL
YRFCSRNGINARHIEPILRRSQMQMVSLERDPATDKLVQDRPTIEIIFRRFMGSEGPNLK
SSTSLSDSDSVSEYATGLVGIKMAKERRVLDKLVNNTFTGKAASDWLLDCCTTIDRRETY
EMAELFVKWQLMVPVVEDRAYVRANPMATYFQPTKHAVYTITERGQRVCGWLARPPSIDS
EDSRDIKDPKSRLAKDSNVNRLNVILQDAALRLLFKEFLRQSLCEENLQFYFDVSDFTSN
YRDLEKSGKLERPEAVRETLAAAYGLYNSFLASGAPSELNIDHSLRNRLDSRMIRTNTDE
ESMRGGLEEVVELFELAQNVVFKLMASDSVPKFLRDPRHAAVLRDHEIDLIGSNRTLSPG
PERTISRSNTRS
Download sequence
Identical sequences A0A0D2G4H6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]