SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2HC35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2HC35
Domain Number 1 Region: 15-131
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.61e-35
Family Ribosomal proteins L24p and L21e 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2HC35
Sequence length 138
Comment (tr|A0A0D2HC35|A0A0D2HC35_9EURO) Unplaced genomic scaffold supercont1.3, whole genome shotgun sequence {ECO:0000313|EMBL:KIW82114.1} KW=Complete proteome; Reference proteome OX=1442368 OS=Fonsecaea pedrosoi CBS 271.37. GN=Z517_05141 OC=Fonsecaea.
Sequence
MKTEINTWLPAGLASSRRKSRKLHFGAPSSVRRTIMSAPLSKELREKHNVRSIPIRKDDE
VTIVRGSNKGREGKVTSVYRLKYLIHIERVSREKSNGQSVPIGVHPSKVVVTKLKLDKDR
EKILERIGKGREAVKSKE
Download sequence
Identical sequences A0A0D2HC35
XP_013285922.1.45204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]