SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2HN39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2HN39
Domain Number 1 Region: 41-89,210-281
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000000078
Family Regulator of G-protein signaling, RGS 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2HN39
Sequence length 470
Comment (tr|A0A0D2HN39|A0A0D2HN39_XYLBA) Unplaced genomic scaffold supercont1.10, whole genome shotgun sequence {ECO:0000313|EMBL:KIW92245.1} KW=Complete proteome OX=1442370 OS=Cladophialophora bantiana CBS 173.52. GN=Z519_07229 OC=Cladophialophora.
Sequence
MVLSLSYRRPAYVTSSRDSVESEKGGRVESINSNSSCPYGIPDALSFDRIISGGTCPPVT
TRQFMDFLRYIEYDAENLQFYLWYHDYCKRFDGLPDSEKKLSPEWNVDQALAEKTNAEKE
KLPKKMASAAAAAVLKGTDFDPHAKLAAPDAGPNPFSTPPRTPSATATDHDSMAPSTVGY
SEDATTLRAGTIDHGKRAKAAFEETGNLQPFTIQPFREEISRIIAIYIADGGARLLNLSA
KEKAVLLKALSVTTHPSAFRDVIATVEWTLRHQAHPNFIRWTICNGNKPRQAFARFLGVA
GIVGGIVYAIVITLSSVSRGWRALAFLGLFIGIATLFAAWKGMCVVLHGMHHRHLRPWEL
FDDEDEASCDHGLKKSSFDSLGSSNSYEDEPWVAKYEKRNIIRKIFDREVWIQEPALRQI
QDTIFVQALITASVVGAITTAIFLAVREDPFSNLVPASNLNNQVPRGNFY
Download sequence
Identical sequences A0A0D2HN39
XP_016618914.1.57598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]