SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2I2Z0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2I2Z0
Domain Number 1 Region: 67-175
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 6.15e-39
Family FAD-dependent thiol oxidase 0.0000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2I2Z0
Sequence length 212
Comment (tr|A0A0D2I2Z0|A0A0D2I2Z0_9EURO) Sulfhydryl oxidase {ECO:0000256|RuleBase:RU371123} KW=Complete proteome; Reference proteome OX=1442369 OS=Rhinocladiella mackenziei CBS 650.93. GN=Z518_10281 OC=Rhinocladiella.
Sequence
MPRAPPPFMIILSAIALFVWYVVWTRDHERPMTALSHADRFRSKFEADTPIATTEIVHGE
HVMGKLGNETLKAELGRAAWKVLHTTMARFPDKPTQDESDALKNYLYLFARLYPCGECAE
HFQTILKKYPPQTSSRSSAAAWACFVHNLVNERKGKPIFDCSNIGDFYDCGCGDDEKEAI
SSAGAKSSSVAQDNPPRHEPVEIEVEGETRGG
Download sequence
Identical sequences A0A0D2I2Z0
XP_013267280.1.10589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]