SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2IPK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2IPK5
Domain Number 1 Region: 9-59,182-264
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-23
Family Regulator of G-protein signaling, RGS 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2IPK5
Sequence length 378
Comment (tr|A0A0D2IPK5|A0A0D2IPK5_9EURO) Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.2, whole genome shotgun sequence {ECO:0000313|EMBL:KIX07824.1} KW=Complete proteome; Reference proteome OX=1442369 OS=Rhinocladiella mackenziei CBS 650.93. GN=Z518_02478 OC=Rhinocladiella.
Sequence
MAKANPDQEPEQRNRLPTLMEVLGRRTLAPVDLFSFYIFMRDQQRSVDYLDFWLDVSQHM
SLCRHYVRELRRSMLVDTPEMEKAASKRSSALPESFDLGEGLDSRKSGQESRVSAILRSD
NGPARKPGSREGGVDHSPSHSMGSAHSRNLSRPSGDRPSPSEPPQTSLLTPEVRTDSNSP
GHSVTRADIKASAEKILYTFVLPGSEREIVLPDSMLNKIIRAIEEEGRDDPEVFDDAKDY
VFQAMERDAFPGFLQAKALGNLVPLSVLIRLIVGLASLMGGFWGGYYMILRDESRRIRCW
LILPYTIGTYFLVSYQYKLDIIAAYIGFSEYTWMNWSRVREPFVRRLLLTRATMAFLMFA
AAAVALSVLFIFVPGTRF
Download sequence
Identical sequences A0A0D2IPK5
XP_013274960.1.10589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]