SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2JL26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2JL26
Domain Number 1 Region: 219-268
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000602
Family Pseudo ankyrin repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2JL26
Sequence length 369
Comment (tr|A0A0D2JL26|A0A0D2JL26_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KIX85078.1} KW=Complete proteome; Reference proteome OX=1306947 OS=candidate division TM6 bacterium JCVI TM6SC1. GN=J120_04040 OC=Bacteria; Candidatus Dependentiae; Vermiphilus.
Sequence
MDIIRIILVSIIFICSSDCILAVEKNTQDQFLPDDIIYNEIIAQYASDMNTQALKLANQF
PDINAISQAAREYIVGYNQLTSANKKISELIQRNIITNFINPLVIALQKQMQLSDTAKTD
FFDRILPLERYYKLSLPKLGTAINFVPQEFIAALLGDKGFTGFIRQKNTSIVQQQILLLF
LYQSYISLEYNPRKGVYESVLFFEQNKKIVVTQKQLNTMIARLLQAGISPDFGFNNNSLL
FYAIDNYNTDLFRILIQNGASLDAKRYLFPFEMSHYLIDAIYNQFIDKYHKLSVFINLAQ
DKLVTYLTLEKIAMLSKQLKQIQEYQNMLNILKSQDIQWYQAHIASYPYLENNLQELINQ
LQLLIKKYF
Download sequence
Identical sequences A0A0D2JL26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]