SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2JW46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2JW46
Domain Number 1 Region: 5-267
Classification Level Classification E-value
Superfamily EreA/ChaN-like 5.75e-50
Family ChaN-like 0.03
Further Details:      
 
Domain Number 2 Region: 272-353
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000158
Family HtrA-like serine proteases 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2JW46
Sequence length 357
Comment (tr|A0A0D2JW46|A0A0D2JW46_9DELT) Uncharacterized protein {ECO:0000313|EMBL:KIX13835.1} KW=Complete proteome; Reference proteome OX=1429043 OS=Dethiosulfatarculus sandiegensis. GN=X474_11125 OC=Desulfarculaceae; Dethiosulfatarculus.
Sequence
MPSVQVGEVFYPQAEKSLGAKDLDQTLSQAQIILLGETHTNPHHHLIQLKMLKDFNRVNQ
ARIIVGIEWLDASAQPACARLSAGKITVSEFAQEVDWPHTWGFPLELYKPILEYVRKEGL
TLVPLSAPTRIIKQIAQNGLNSLSPEQRDAIAPSLDLDDTLYRTQLKPRFTEHGIMEPKA
ADYFINAQIARDETMAHNLAKHLLPWPQAEAKAVLLAGSGHMTGGLGLKPRILRRLPGAR
LLTVIPVSEKAMAAMGGQLTKLADLVVISEPTPSHRPRLGLFLKPVDQGLLVERVMPKSR
AETAGIKAGDILVNIDGQPVRQVMDIHRLIRDNPEKQREYNLLRQGSQFNTNISLSR
Download sequence
Identical sequences A0A0D2JW46

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]