SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2LDQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2LDQ9
Domain Number 1 Region: 177-258
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000863
Family Pseudo ankyrin repeat 0.024
Further Details:      
 
Domain Number 2 Region: 152-387
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000149
Family Ankyrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0D2LDQ9
Sequence length 413
Comment (tr|A0A0D2LDQ9|A0A0D2LDQ9_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:KIZ04849.1} KW=Complete proteome; Reference proteome OX=145388 OS=Monoraphidium neglectum. GN=MNEG_3110 OC=Selenastraceae; Monoraphidium.
Sequence
MAAVDSDRGGEGGRSSSSSSSSSSSSSSSSSSSSSSRTCGEHPITPHACTGADTDPPPAA
GPATSISHPHLLAAIFERLPPGEQCVTIGALDHAWRRWAAPKRAALRAARPSECWVDYRF
ELFGMFALPLWYVMDRWPLLTEEQRYGAALRAAVHGDVETLRFARHAGCRLDKSVCNAAA
SGGHLAALQWAHGAGCSLTSWTCASAAAGGHLQLLRWLHGAGCPWDEWTCEAAAQGGHLE
LLRWARGAGCPWDENTCDAAAGAGQLAVLQWAHAAGCPWRARTCEAAAQGEHLELLRWAR
GAGCPWDQHTCQAAARRGALDVLQWARDAGCPWGTEVCVSASFFGHLHILTWARGEGCPW
DERTCETAARRGHLHVLRWARDAGCPWNRQMCRKLAQTSRRAAVVEWIDGQPE
Download sequence
Identical sequences A0A0D2LDQ9
XP_013903868.1.7768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]