SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2LRF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2LRF1
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily SRF-like 2.22e-31
Family SRF-like 0.00022
Further Details:      
 
Weak hits

Sequence:  A0A0D2LRF1
Domain Number - Region: 114-184
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00288
Family Apolipoprotein A-I 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2LRF1
Sequence length 237
Comment (tr|A0A0D2LRF1|A0A0D2LRF1_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB06557.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_001G090000 OC=Gossypium.
Sequence
MGRGRVQLRRIENNISRQVTFSKRRSGLLKKAHEISVLCDADVALIVFSNKGKLFEFSSD
PSMERILERYERQIYAPTGSESQANWSLESSKLMSTIEVLQRSLRNFRGEELEPLSLRDL
QLLEQQIGNSLKRIRTRKNKLMNESISVLQKREKTLQDQNNMLAKKLKEKQQTPTEHAQH
EVQQKFVQNSPPSTSVQPPTPPPAAIQFPCLTIGGSYEAMKGTNKEAELNLNLVPNQ
Download sequence
Identical sequences A0A0D2LRF1
XP_012472168.1.20347 Gorai.001G090000.2|PACid:26824442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]