SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2M033 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0D2M033
Domain Number - Region: 7-49
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.00184
Family Poly(A) polymerase, PAP, middle domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2M033
Sequence length 66
Comment (tr|A0A0D2M033|A0A0D2M033_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB09997.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_001G179500 OC=Gossypium.
Sequence
MFPMSPLMSGVAATTVVATVLVSATTVSACLLFFSFFAFPLSLQWKNNERDENGASVFRV
LKHPKR
Download sequence
Identical sequences A0A0D2M033
Gorai.001G179500.1|PACid:26821744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]