SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2M514 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2M514
Domain Number 1 Region: 238-337
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.53e-22
Family B3 DNA binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 3-96
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-20
Family B3 DNA binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0D2M514
Sequence length 353
Comment (tr|A0A0D2M514|A0A0D2M514_GOSRA) Uncharacterized protein {ECO:0000313|EMBL:KJB12217.1} KW=Complete proteome; Reference proteome OX=29730 OS=Gossypium raimondii (New World cotton). GN=B456_002G006500 OC=Gossypium.
Sequence
MPRPFFHKLILSSTLQDKKLRIPDNFVKKFKDELSVAAALTVPDGHVWRVGIRKGDNKVW
FQEGWPEFLDRYYIRIGYFLIFRYEGNSAFSVSIFNLYNSEINYQSNALLGSQYNHGKSY
PFDELEDDECMSSAMQHLFGGSKLNHCVNWSGEVNLNAAKSANNQPIRVKLRTSGSETPP
PKKPGRKKQKFDPNDQDLSVGHEDDSEMRYRFYESASARKRTVTAEERERAMNAAKAFEP
SNPFCRVVLRPSYLYRGCIMYLPSCFAEHLSGVSGFIKLQLPDGKQWSVRCLYRGGKAKF
SQGWYEFTVENNLGEGDVCVFELLRSREFVLKVTVFRVMDGAGLMHRSQYNAN
Download sequence
Identical sequences A0A0D2M514
Gorai.002G006500.1|PACid:26795863 XP_012450169.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]