SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0D2M9B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0D2M9B6
Domain Number 1 Region: 378-419,458-502,534-563
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.58e-18
Family Regulator of G-protein signaling, RGS 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0D2M9B6
Sequence length 580
Comment (tr|A0A0D2M9B6|A0A0D2M9B6_9AGAR) Uncharacterized protein {ECO:0000313|EMBL:KJA19938.1} KW=Complete proteome; Reference proteome OX=945553 OS=Hypholoma sublateritium FD-334 SS-4. GN=HYPSUDRAFT_68936 OC=Hypholoma.
Sequence
MVSFATTAETIPPEMDLSLTSGLRKTKFGTLFQKDAWDLFSSLMLTLELTTHKQMGFKAY
RDTFLGHEAVQSLRSLKFIRSPDTRDLSNLVPLSTRTAKLSEDSALAVLQHFLDASLIID
ATKKETLHFKKKGIYTPTPKGLLVLEEFLQTCDLESEADHLIAILSSRPTPRPKLTRLER
RGADDELVITQLTIANLFRDFVGPFPNFDWKNHTGVLLFSEKQAYKLLKDVFKRDDRPFG
GKASSIRTTHCVGAPIIIHWLCDNTVISSPQEAAEVAAQFIRFGLLVLVDDRAEKGESVS
TFKVTGSTSRGNPSLSGTAEFRYSHRGVYAITDEGNFLAGWPGKQLPSMVFVSDLLATVP
GADQDAEPPSEEPVNAENAEYLRTFLKDPSLLVLFRQFLSEKRREHDLSFWIDVEDFKVA
FEKVAMVMRSPPPPPPPPVAGSSKTPMEPSPPPDRPHETLGNIPFLIYNTYLAPSSECKI
SINIGSELREELQRSLEHCIEYLTNKVSATTNDEFAPGDSTTLEIDQLEILVWLYDRIQT
RIFSALAKHAVSRFLRWPKYKALRTDALESVAEDSEHSSS
Download sequence
Identical sequences A0A0D2M9B6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]